- Leukotriene B4 Receptor 2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89960
- Human
- BLT2, BLTR2, JULF2, KPG_004, LTB4-R 2, LTB4-R2, NOP9
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: MAPSHRASQV GFCPTPERPL WRLPPTCRPR RMSVCYRPPG NETLLSWKTS R
- Leukotriene B4 Receptor 2
- Rabbit
- leukotriene B4 receptor 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- GPCR, Immunology, Innate Immunity
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR
Specifications/Features
Available conjugates: Unconjugated